PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G192900.2
Common NameB456_008G192900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 286aa    MW: 31981.7 Da    PI: 6.6806
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G192900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.2e-163277148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg++T++E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Gorai.008G192900.2 32 RGNFTEQEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 77
                        89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.1351326IPR017877Myb-like domain
SuperFamilySSF466899.84E-221386IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-101337IPR009057Homeodomain-like
PROSITE profilePS5129424.7752781IPR017930Myb domain
SMARTSM007176.5E-163179IPR001005SANT/Myb domain
PfamPF002492.7E-153277IPR001005SANT/Myb domain
CDDcd001672.09E-113477No hitNo description
Gene3DG3DSA:1.10.10.602.0E-213882IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MIFFNVDVSG LLRCSKSCRL RWTNYLRPGI KRGNFTEQEE KMIIHLQALL GNRWAAIASY  60
LPQRTDNDIK NYWNTHLKKK LKKVETGVDG QNQEGFSSAQ SVSKGQWERR LQTDIRMAKQ  120
ALSDALSLDK PNSLTNSIEF KLSHPYLRPS QSQSSTAYAS SAENISRLLQ NWMKNPPKPA  180
PAPRQTKSAE TMTQNSSCSD EGALSEATPE GFDSFFSFNS SNSDNISHES VSVAENSVFQ  240
DESKPNLGDQ VPLRLIEKWL LDDASAQAHD DDLISMSLQD SALLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-19138140108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00395DAPTransfer from AT3G47600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5890382e-75JX589038.1 Gossypium hirsutum clone NBRI_GE23645 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438755.10.0PREDICTED: myb-related protein 306
SwissprotP813924e-94MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D2U5Y20.0A0A0D2U5Y2_G
STRINGVIT_17s0000g06190.t011e-106(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.12e-76myb domain protein 94
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]